Lineage for d2c2vs1 (2c2v S:227-301)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751391Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 751392Superfamily g.44.1: RING/U-box [57850] (4 families) (S)
  5. 751440Family g.44.1.2: U-box [90222] (4 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 751453Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species)
  7. 751454Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries)
  8. 751455Domain d2c2vs1: 2c2v S:227-301 [129694]
    Other proteins in same PDB: d2c2vb1, d2c2vc1, d2c2ve1, d2c2vf1, d2c2vh1, d2c2vi1, d2c2vk1, d2c2vl1

Details for d2c2vs1

PDB Entry: 2c2v (more details), 2.9 Å

PDB Description: crystal structure of the chip-ubc13-uev1a complex
PDB Compounds: (S:) carboxy terminus of hsp70-interacting protein

SCOP Domain Sequences for d2c2vs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2vs1 g.44.1.2 (S:227-301) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
mkevidafisengwv

SCOP Domain Coordinates for d2c2vs1:

Click to download the PDB-style file with coordinates for d2c2vs1.
(The format of our PDB-style files is described here.)

Timeline for d2c2vs1: