Lineage for d2btfa1 (2btf A:2-146)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (7 species) 
Species Cow (Bos taurus) [TaxId:9913] [53074] (3 PDB entries) 
Domain d2btfa1: 2btf A:2-146 [33429]
Other proteins in same PDB: d2btfp_
complexed with atp, sr
Details for d2btfa1
PDB Entry: 2btf (more details), 2.55 Å
PDB Description: the structure of crystalline profilin-beta-actin
PDB Compounds: (A:) beta-actinSCOPe Domain Sequences for d2btfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btfa1 c.55.1.1 (A:2-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg
SCOPe Domain Coordinates for d2btfa1:
Click to download the PDB-style file with coordinates for d2btfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2btfa1:
- d2btfa1 first appeared (with stable ids) in SCOP 1.55
- d2btfa1 appears in SCOPe 2.03
- d2btfa1 appears in SCOPe 2.05
- d2btfa1 appears in the current release, SCOPe 2.08
View in 3D
