![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
![]() | Protein Profilin (actin-binding protein) [55772] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries) |
![]() | Domain d2btfp_: 2btf P: [40867] Other proteins in same PDB: d2btfa1, d2btfa2 complexed with atp, sr |
PDB Entry: 2btf (more details), 2.55 Å
SCOPe Domain Sequences for d2btfp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btfp_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg gminkkcyemashlrrsqy
Timeline for d2btfp_: