Lineage for d2bnea1 (2bne A:5-241)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843596Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 843597Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 843640Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 843660Protein Uridylate kinase PyrH [142728] (6 species)
  7. 843664Species Escherichia coli [TaxId:562] [142730] (4 PDB entries)
    Uniprot P0A7E9 4-240
  8. 843665Domain d2bnea1: 2bne A:5-241 [128824]
    automatically matched to 2BND A:5-241
    complexed with gol, u5p; mutant

Details for d2bnea1

PDB Entry: 2bne (more details), 2.3 Å

PDB Description: the structure of e. coli ump kinase in complex with ump
PDB Compounds: (A:) uridylate kinase

SCOP Domain Sequences for d2bnea1:

Sequence, based on SEQRES records: (download)

>d2bnea1 c.73.1.3 (A:5-241) Uridylate kinase PyrH {Escherichia coli [TaxId: 562]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records): (download)

>d2bnea1 c.73.1.3 (A:5-241) Uridylate kinase PyrH {Escherichia coli [TaxId: 562]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpptatmyeql
tysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

SCOP Domain Coordinates for d2bnea1:

Click to download the PDB-style file with coordinates for d2bnea1.
(The format of our PDB-style files is described here.)

Timeline for d2bnea1: