SCOP 1.75: Domain d2bneb1: 2bne B:5-241

Lineage for d2bneb1 (2bne B:5-241)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Uridylate kinase PyrH [142728] (6 species)

7. Species Escherichia coli [TaxId:562] [142730] (4 PDB entries)
   Uniprot P0A7E9 4-240

8. Domain d2bneb1: 2bne B:5-241 [128825]
   automatically matched to 2BND A:5-241
   complexed with gol, u5p; mutant

Details for d2bneb1

PDB Entry: 2bne, 2.3 Å

PDB Description: the structure of e. coli ump kinase in complex with ump

PDB Compounds: (B:) uridylate kinase

SCOP Domain Sequences for d2bneb1:

Sequence, based on SEQRES records:

>d2bneb1 c.73.1.3 (B:5-241) Uridylate kinase PyrH {Escherichia coli [TaxId: 562]}
akpvykrillklsgealqgtegfgidasildrmaqeikelvelgiqvgvvigggnlfrga
glakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeais
llrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmy
eqltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Sequence, based on observed residues (ATOM records):

>d2bneb1 c.73.1.3 (B:5-241) Uridylate kinase PyrH {Escherichia coli [TaxId: 562]}
akpvykrillklsgealqgtefgidasildrmaqeikelvelgiqvgvvigggnlfrgag
lakagmnrvvgdhmgmlatvmnglamrdalhrayvnarlmsaiplngvcdsyswaeaisl
lrnnrvvilsagtgnpffttdsaaclrgieieanvvlkatkvdgvftadpakdptatmye
qltysevlekelkvmdlaaftlardhklpirvfnmnkpgalrrvvmgekegtlite

Timeline for d2bneb1:

• d2bneb1 first appeared in SCOP 1.73
  
• d2bneb1 is called d2bneb_ in SCOPe 2.01
  
• d2bneb1 appears in the current release, SCOPe 2.08, called d2bneb_