Lineage for d2blma_ (2blm A:)
- Root: SCOPe 2.02
Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) 
Protein beta-Lactamase, class A [56606] (15 species) 
Species Bacillus licheniformis [TaxId:1402] [56612] (10 PDB entries) 
Domain d2blma_: 2blm A: [42725]
CA-atoms only
Details for d2blma_
PDB Entry: 2blm (more details), 2 Å
PDB Description: beta-lactamase of bacillus licheniformis 749(slash)c at 2 angstroms resolution
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d2blma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2blma_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkalnmngk
SCOPe Domain Coordinates for d2blma_:
Click to download the PDB-style file with coordinates for d2blma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2blma_:
- d2blma_ first appeared (with stable ids) in SCOP 1.55
- d2blma_ appears in SCOPe 2.01
- d2blma_ appears in SCOPe 2.03
- d2blma_ appears in the current release, SCOPe 2.08
View in 3D
