Lineage for d2blma_ (2blm A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013004Species Bacillus licheniformis [TaxId:1402] [56612] (14 PDB entries)
  8. 3013019Domain d2blma_: 2blm A: [42725]
    CA-atoms only

Details for d2blma_

PDB Entry: 2blm (more details), 2 Å

PDB Description: beta-lactamase of bacillus licheniformis 749(slash)c at 2 angstroms resolution
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d2blma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blma_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkalnmngk

SCOPe Domain Coordinates for d2blma_:

Click to download the PDB-style file with coordinates for d2blma_.
(The format of our PDB-style files is described here.)

Timeline for d2blma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2blmb_