Lineage for d2bcka2 (2bck A:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1641866Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1641959Domain d2bcka2: 2bck A:1-181 [128294]
    Other proteins in same PDB: d2bcka1, d2bckb_, d2bckd1, d2bcke_
    automatically matched to d1akja2
    complexed with gol, so4

Details for d2bcka2

PDB Entry: 2bck (more details), 2.8 Å

PDB Description: Crystal Structure of HLA-A*2402 Complexed with a telomerase peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-24 alpha chain

SCOPe Domain Sequences for d2bcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfstsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
deetgkvkahsqtdrenlrialryynqseagshtlqmmfgcdvgsdgrflrgyhqyaydg
kdyialkedlrswtaadmaaqitkrkweaahvaeqqraylegtcvdglrrylengketlq
r

SCOPe Domain Coordinates for d2bcka2:

Click to download the PDB-style file with coordinates for d2bcka2.
(The format of our PDB-style files is described here.)

Timeline for d2bcka2:

1641959
d2bcka2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2bcka1