Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d2bcka2: 2bck A:1-181 [128294] Other proteins in same PDB: d2bcka1, d2bckb_, d2bckd1, d2bcke_ automatically matched to d1akja2 complexed with gol, so4 |
PDB Entry: 2bck (more details), 2.8 Å
SCOPe Domain Sequences for d2bcka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfstsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw deetgkvkahsqtdrenlrialryynqseagshtlqmmfgcdvgsdgrflrgyhqyaydg kdyialkedlrswtaadmaaqitkrkweaahvaeqqraylegtcvdglrrylengketlq r
Timeline for d2bcka2:
View in 3D Domains from other chains: (mouse over for more information) d2bckb_, d2bckd1, d2bckd2, d2bcke_ |