Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species) |
Species Ureaplasma urealyticum [TaxId:2130] [117561] (2 PDB entries) Uniprot Q9PPP5 11-211 |
Domain d2b8ta1: 2b8t A:11-149 [128109] Other proteins in same PDB: d2b8ta2, d2b8tb2, d2b8tc2, d2b8td2 complexed with thm, trs, zn |
PDB Entry: 2b8t (more details), 2 Å
SCOPe Domain Sequences for d2b8ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg epfgpiaklftyadkitkl
Timeline for d2b8ta1: