Lineage for d2b8tc1 (2b8t C:11-149)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849565Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 1849566Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 1849583Species Ureaplasma urealyticum [TaxId:2130] [117561] (2 PDB entries)
    Uniprot Q9PPP5 11-211
  8. 1849586Domain d2b8tc1: 2b8t C:11-149 [128113]
    Other proteins in same PDB: d2b8ta2, d2b8tb2, d2b8tc2, d2b8td2
    automated match to d2b8ta1
    complexed with thm, trs, zn

Details for d2b8tc1

PDB Entry: 2b8t (more details), 2 Å

PDB Description: crystal structure of thymidine kinase from u.urealyticum in complex with thymidine
PDB Compounds: (C:) Thymidine kinase

SCOPe Domain Sequences for d2b8tc1:

Sequence, based on SEQRES records: (download)

>d2b8tc1 c.37.1.24 (C:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl

Sequence, based on observed residues (ATOM records): (download)

>d2b8tc1 c.37.1.24 (C:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidsrtgtslpsvevesapeil
nyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkgepfgpiak
lftyadkitkl

SCOPe Domain Coordinates for d2b8tc1:

Click to download the PDB-style file with coordinates for d2b8tc1.
(The format of our PDB-style files is described here.)

Timeline for d2b8tc1: