Lineage for d2auwa2 (2auw A:4-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011145Fold d.331: NE0471 N-terminal domain-like [143879] (1 superfamily)
    beta(3)-alpha(n)-beta(3)-alpha; the two meander beta-sheets and helices are packed against the same core
  4. 3011146Superfamily d.331.1: NE0471 N-terminal domain-like [143880] (1 family) (S)
    automatically mapped to Pfam PF10387
  5. 3011147Family d.331.1.1: NE0471 N-terminal domain-like [143881] (1 protein)
  6. 3011148Protein Hypothetical protein NE0471 N-terminal domain [143882] (1 species)
  7. 3011149Species Nitrosomonas europaea [TaxId:915] [143883] (1 PDB entry)
    Uniprot Q82X29 4-87
  8. 3011150Domain d2auwa2: 2auw A:4-87 [127340]
    Other proteins in same PDB: d2auwa1, d2auwb1
    complexed with fmt, gol

Details for d2auwa2

PDB Entry: 2auw (more details), 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718
PDB Compounds: (A:) hypothetical protein NE0471

SCOPe Domain Sequences for d2auwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2auwa2 d.331.1.1 (A:4-87) Hypothetical protein NE0471 N-terminal domain {Nitrosomonas europaea [TaxId: 915]}
yffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhiaeweg
svewfdtefgrdnvyawakeqage

SCOPe Domain Coordinates for d2auwa2:

Click to download the PDB-style file with coordinates for d2auwa2.
(The format of our PDB-style files is described here.)

Timeline for d2auwa2:

3011150
d2auwa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2auwa1