PDB entry 2auw

View 2auw on RCSB PDB site
Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718
Class: unknown function
Keywords: alpha-beta structure, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-08-29, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein NE0471
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82X29
      • modified residue (93)
      • modified residue (98)
      • modified residue (118)
    Domains in SCOPe 2.07: d2auwa1, d2auwa2
  • Chain 'B':
    Compound: hypothetical protein NE0471
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82X29 (2-End)
      • modified residue (2)
      • modified residue (93)
      • modified residue (98)
      • modified residue (118)
    Domains in SCOPe 2.07: d2auwb1, d2auwb2
  • Heterogens: GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2auwA (A:)
    ghmneyffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhi
    aewegsvewfdtefgrdnvyawakeqagevshemfgdwmhrnnlslttaaealgisrrmv
    syyrtahkiiprtiwlaclgweatrpetktlprtlpaayakgvsaslsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2auwA (A:)
    yffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhiaeweg
    svewfdtefgrdnvyawakeqagevshemfgdwmhrnnlslttaaealgisrrmvsyyrt
    ahkiiprtiwlaclgweatrpetktlprtlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2auwB (B:)
    ghmneyffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhi
    aewegsvewfdtefgrdnvyawakeqagevshemfgdwmhrnnlslttaaealgisrrmv
    syyrtahkiiprtiwlaclgweatrpetktlprtlpaayakgvsaslsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2auwB (B:)
    mneyffpkltavealapyrlrttwstgevlevdvgdilrkipdlapildpeafarvhiae
    wegsvewfdtefgrdnvyawakeqagevshemfgdwmhrnnlslttaaealgisrrmvsy
    yrtahkiiprtiwlaclgweatrpetktlprtlpa