SCOPe 2.08: Domain d2auwb1: 2auw B:88-155

Lineage for d2auwb1 (2auw B:88-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.10: NE0471 C-terminal domain-like [140523] (1 protein)

6. Protein Hypothetical protein NE0471 C-terminal domain [140524] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [140525] (1 PDB entry)
   Uniprot Q82X29 88-154

8. Domain d2auwb1: 2auw B:88-155 [127341]
   Other proteins in same PDB: d2auwa2, d2auwb2
   automated match to d2auwa1
   complexed with fmt, gol

Details for d2auwb1

PDB Entry: 2auw, 1.85 Å

PDB Description: Crystal Structure of Putative DNA Binding Protein NE0471 from Nitrosomonas europaea ATCC 19718

PDB Compounds: (B:) hypothetical protein NE0471

SCOPe Domain Sequences for d2auwb1:

Sequence; same for both SEQRES and ATOM records:

>d2auwb1 a.35.1.10 (B:88-155) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]}
vshemfgdwmhrnnlslttaaealgisrrmvsyyrtahkiiprtiwlaclgweatrpetk
tlprtlpa

Timeline for d2auwb1:

• d2auwb1 first appeared in SCOP 1.73
  
• d2auwb1 appears in SCOPe 2.07