Lineage for d2ahkb_ (2ahk B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family) 
Pfam PF06236Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein) Protein Tyrosinase cofactor MelC1 [254410] (1 species) Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (22 PDB entries) 
Domain d2ahkb_: 2ahk B: [241231]
Other proteins in same PDB: d2ahka_
complexed with cu, no3
Details for d2ahkb_
PDB Entry: 2ahk (more details), 1.71 Å
PDB Description: Crystal structure of the met-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
PDB Compounds: (B:) caddie protein orf378SCOPe Domain Sequences for d2ahkb_:
Sequence, based on SEQRES records: (download)
>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp
Sequence, based on observed residues (ATOM records): (download)
>d2ahkb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshydpvptpraaara
avdelqgapllp
SCOPe Domain Coordinates for d2ahkb_:
Click to download the PDB-style file with coordinates for d2ahkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ahkb_:
- d2ahkb_ is new in SCOPe 2.04-stable
- d2ahkb_ appears in SCOPe 2.05
- d2ahkb_ appears in the current release, SCOPe 2.08
View in 3D
