Lineage for d2aeea1 (2aee A:1-208)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Orotate PRTase [53290] (3 species) Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry)
Uniprot Q9A076 1-208
Domain d2aeea1: 2aee A:1-208 [126620]
Other proteins in same PDB: d2aeea2
complexed with cl, gol, so4
Details for d2aeea1
PDB Entry: 2aee (more details), 1.95 Å
PDB Description: Crystal structure of Orotate phosphoribosyltransferase from Streptococcus pyogenes
PDB Compounds: (A:) orotate phosphoribosyltransferaseSCOPe Domain Sequences for d2aeea1:
Sequence, based on SEQRES records: (download)
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi
iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli
avaklqgyitndglhllkkfkedqvnwq
Sequence, based on observed residues (ATOM records): (download)
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkgnqiegrvlkgqkmviiedl
istggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavak
lqgyitndglhllkkfkedqvnwq
SCOPe Domain Coordinates for d2aeea1:
Click to download the PDB-style file with coordinates for d2aeea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aeea1:
- d2aeea1 first appeared in SCOP 1.73
- d2aeea1 appears in SCOPe 2.07
View in 3D
