Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (2 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
Protein Orotate PRTase [53290] (3 species) |
Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry) |
Domain d2aeea1: 2aee A:1-208 [126620] complexed with cl, gol, so4 |
PDB Entry: 2aee (more details), 1.95 Å
SCOP Domain Sequences for d2aeea1:
Sequence, based on SEQRES records: (download)
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli avaklqgyitndglhllkkfkedqvnwq
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti kahfpeveviagtatagiphgaiiadkmtlpfayirskpkgnqiegrvlkgqkmviiedl istggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavak lqgyitndglhllkkfkedqvnwq
Timeline for d2aeea1: