Lineage for d2aeeb_ (2aee B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891558Protein Orotate PRTase [53290] (3 species)
  7. 2891567Species Streptococcus pyogenes [TaxId:1314] [142553] (1 PDB entry)
    Uniprot Q9A076 1-208
  8. 2891569Domain d2aeeb_: 2aee B: [126621]
    Other proteins in same PDB: d2aeea2
    automated match to d2aeea1
    complexed with cl, gol, so4

Details for d2aeeb_

PDB Entry: 2aee (more details), 1.95 Å

PDB Description: Crystal structure of Orotate phosphoribosyltransferase from Streptococcus pyogenes
PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d2aeeb_:

Sequence, based on SEQRES records: (download)

>d2aeeb_ c.61.1.1 (B:) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpkdhgagnqiegrvlkgqkmvi
iedlistggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteli
avaklqgyitndglhllkkfkedqvnwqq

Sequence, based on observed residues (ATOM records): (download)

>d2aeeb_ c.61.1.1 (B:) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]}
mtlasqiatqlldikavylkpedpftwasgikspiytdnrvtlsypktrdliengfveti
kahfpeveviagtatagiphgaiiadkmtlpfayirskpnqiegrvlkgqkmviiedlis
tggsvldaaaaasregadvlgvvaiftyelpkasqnfkeagiklitlsnyteliavaklq
gyitndglhllkkfkedqvnwqq

SCOPe Domain Coordinates for d2aeeb_:

Click to download the PDB-style file with coordinates for d2aeeb_.
(The format of our PDB-style files is described here.)

Timeline for d2aeeb_: