Lineage for d2a5db1 (2a5d B:1-186)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual foldSuperfamily d.166.1: ADP-ribosylation [56399] (8 families) 
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) 
Protein Cholera toxin [56410] (1 species) Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries) 
Domain d2a5db1: 2a5d B:1-186 [144783]
Other proteins in same PDB: d2a5da_
complexed with gol, gtp, mg, na
Details for d2a5db1
PDB Entry: 2a5d (more details), 1.8 Å
PDB Description: structural basis for the activation of cholera toxin by human arf6-gtp
PDB Compounds: (B:) Cholera enterotoxin, A chainSCOPe Domain Sequences for d2a5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5db1 d.166.1.1 (B:1-186) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappg
SCOPe Domain Coordinates for d2a5db1:
Click to download the PDB-style file with coordinates for d2a5db1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a5db1:
- d2a5db1 first appeared in SCOP 1.75
- d2a5db1 appears in SCOPe 2.03
- d2a5db1 appears in SCOPe 2.05
- d2a5db1 appears in the current release, SCOPe 2.08
View in 3D
