Lineage for d2a5db1 (2a5d B:1-186)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558129Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2558148Protein Cholera toxin [56410] (1 species)
  7. 2558149Species Vibrio cholerae [TaxId:666] [56411] (9 PDB entries)
  8. 2558151Domain d2a5db1: 2a5d B:1-186 [144783]
    Other proteins in same PDB: d2a5da_
    complexed with gol, gtp, mg, na

Details for d2a5db1

PDB Entry: 2a5d (more details), 1.8 Å

PDB Description: Structural basis for the activation of cholera toxin by human ARF6-GTP
PDB Compounds: (B:) Cholera enterotoxin, A chain

SCOPe Domain Sequences for d2a5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5db1 d.166.1.1 (B:1-186) Cholera toxin {Vibrio cholerae [TaxId: 666]}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyyiyviatapnmfnvndvlgaysphpddqdvsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappg

SCOPe Domain Coordinates for d2a5db1:

Click to download the PDB-style file with coordinates for d2a5db1.
(The format of our PDB-style files is described here.)

Timeline for d2a5db1: