Lineage for d1ztda1 (1ztd A:2-125)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735030Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2735031Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2735070Family a.149.1.2: PF0609-like [140675] (2 proteins)
    specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972)
    automatically mapped to Pfam PF11469
  6. 2735071Protein Hypothetical protein PF0609 [140676] (1 species)
    SECSG target pfu-631545-001
  7. 2735072Species Pyrococcus furiosus [TaxId:2261] [140677] (1 PDB entry)
    Uniprot Q8U363 2-125
  8. 2735073Domain d1ztda1: 1ztd A:2-125 [125639]
    Other proteins in same PDB: d1ztda2, d1ztdb2, d1ztdb3

Details for d1ztda1

PDB Entry: 1ztd (more details), 2 Å

PDB Description: hypothetical protein pfu-631545-001 from pyrococcus furiosus
PDB Compounds: (A:) Hypothetical Protein Pfu-631545-001

SCOPe Domain Sequences for d1ztda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztda1 a.149.1.2 (A:2-125) Hypothetical protein PF0609 {Pyrococcus furiosus [TaxId: 2261]}
eidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkhak
gdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserly
ssqv

SCOPe Domain Coordinates for d1ztda1:

Click to download the PDB-style file with coordinates for d1ztda1.
(The format of our PDB-style files is described here.)

Timeline for d1ztda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztda2