Lineage for d1ztdb2 (1ztd B:2-125)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013374Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2013375Superfamily a.149.1: RNase III domain-like [69065] (3 families) (S)
  5. 2013414Family a.149.1.2: PF0609-like [140675] (2 protein domains)
    specific to Thermococci; shares conserved carboxylic residues and similar dimerisation mode with the RNase III domain; contains integrated in the fold extra C-terminal helix, making it similar to the core fold of Ribosomal protein S7 (47972)
    automatically mapped to Pfam PF11469
  6. 2013418Protein automated matches [190862] (1 species)
    not a true protein
  7. 2013419Species Pyrococcus furiosus [TaxId:2261] [188202] (1 PDB entry)
    automatically mapped to Pfam PF09010
  8. 2013420Domain d1ztdb2: 1ztd B:2-125 [125640]
    Other proteins in same PDB: d1ztda1, d1ztda2, d1ztdb3
    automated match to d1ztda1

Details for d1ztdb2

PDB Entry: 1ztd (more details), 2 Å

PDB Description: Hypothetical Protein Pfu-631545-001 From Pyrococcus furiosus
PDB Compounds: (B:) Hypothetical Protein Pfu-631545-001

SCOPe Domain Sequences for d1ztdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztdb2 a.149.1.2 (B:2-125) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eidkglakfgdslinflyslalteflgkptgdrvpnaslaialeltglsknlrrvdkhak
gdyaealiakawlmglisereaveiikknlypevldfskkkeaigralapllviiserly
ssqv

SCOPe Domain Coordinates for d1ztdb2:

Click to download the PDB-style file with coordinates for d1ztdb2.
(The format of our PDB-style files is described here.)

Timeline for d1ztdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztdb3