Lineage for d1zcaa2 (1zca A:54-82,A:205-371)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476051Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2476093Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 2476097Domain d1zcaa2: 1zca A:54-82,A:205-371 [124898]
    Other proteins in same PDB: d1zcaa1, d1zcab1
    G alpha i/12
    complexed with alf, gdp, mg

Details for d1zcaa2

PDB Entry: 1zca (more details), 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-
PDB Compounds: (A:) G alpha i/12

SCOPe Domain Sequences for d1zcaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcaa2 c.37.1.8 (A:54-82,A:205-371) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq
kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln
kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt
enirfvfhavkdtilqe

SCOPe Domain Coordinates for d1zcaa2:

Click to download the PDB-style file with coordinates for d1zcaa2.
(The format of our PDB-style files is described here.)

Timeline for d1zcaa2:

2476097
d1zcaa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1zcaa1