Lineage for d1zba3_ (1zba 3:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) 
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)Protein automated matches [190854] (25 species)
not a true protein
Species Foot-and-mouth disease virus [TaxId:12110] [188180] (9 PDB entries) 
Domain d1zba3_: 1zba 3: [162438]
automated match to d1bbt3_
Details for d1zba3_
PDB Entry: 1zba (more details), 2 Å
PDB Description: foot-and-mouth disease virus serotype a1061 complexed with oligosaccharide receptor.
PDB Compounds: (3:) coat protein vp3SCOPe Domain Sequences for d1zba3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zba3_ b.121.4.1 (3:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
gifpvacadgygglvttdpktadpvygkvynppktnypgrftnlldvaeacptflrfddg
kpyvvtraddtrllakfdvslaakhmsntylsgiaqyytqysgtinlhfmftgstdskar
ymvayippgvetppdtpeeaahcihaewdtglnskftfsipyvsaadyaytasdtaettn
vqgwvcvyqithgkaendtllvsasagkdfelrlpidprtq
SCOPe Domain Coordinates for d1zba3_:
Click to download the PDB-style file with coordinates for d1zba3_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zba3_:
- d1zba3_ first appeared in SCOPe 2.01
- d1zba3_ appears in SCOPe 2.06
- d1zba3_ appears in the current release, SCOPe 2.08
View in 3D
