Lineage for d1zaea1 (1zae A:67-130)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.251: Phage replication organizer domain [140712] (1 superfamily)
6 helices, homodimer of 3-helical domainsSuperfamily a.251.1: Phage replication organizer domain [140713] (1 family) 
DNA binding induces further oligomerizationFamily a.251.1.1: Phage replication organizer domain [140714] (2 proteins)
Pfam PF06720
Protein Early protein gp16.7 [140715] (1 species) Species Bacteriophage phi-29 [TaxId:10756] [140716] (2 PDB entries)
Uniprot P16517 67-130
Domain d1zaea1: 1zae A:67-130 [124822]
automatically matched to 2C5R A:66-129
Details for d1zaea1
PDB Entry: 1zae (more details)
PDB Description: solution structure of the functional domain of phi29 replication organizer p16.7c
PDB Compounds: (A:) early protein gp16.7SCOPe Domain Sequences for d1zaea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaea1 a.251.1.1 (A:67-130) Early protein gp16.7 {Bacteriophage phi-29 [TaxId: 10756]}
nlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklenqkklyr
gslk
SCOPe Domain Coordinates for d1zaea1:
Click to download the PDB-style file with coordinates for d1zaea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zaea1:
- d1zaea1 first appeared in SCOP 1.73
- d1zaea1 appears in SCOP 1.75
- d1zaea1 appears in SCOPe 2.02
- d1zaea1 appears in the current release, SCOPe 2.08, called d1zaea2
View in 3D
