Lineage for d1z96a1 (1z96 A:295-332)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985425Protein UBA-domain protein mud1 [158356] (1 species)
  7. 1985426Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158357] (1 PDB entry)
    Uniprot Q10256 295-332
  8. 1985427Domain d1z96a1: 1z96 A:295-332 [145960]

Details for d1z96a1

PDB Entry: 1z96 (more details), 1.8 Å

PDB Description: Crystal structure of the Mud1 UBA domain
PDB Compounds: (A:) UBA-domain protein mud1

SCOPe Domain Sequences for d1z96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
glnskiaqlvsmgfdpleaaqaldaangdldvaasfll

SCOPe Domain Coordinates for d1z96a1:

Click to download the PDB-style file with coordinates for d1z96a1.
(The format of our PDB-style files is described here.)

Timeline for d1z96a1:

1985427
d1z96a1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1z96b_