Lineage for d1z96a1 (1z96 A:295-332)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763693Protein UBA-domain protein mud1 [158356] (1 species)
  7. 763694Species Schizosaccharomyces pombe [TaxId:4896] [158357] (1 PDB entry)
    Uniprot Q10256 295-332
  8. 763695Domain d1z96a1: 1z96 A:295-332 [145960]

Details for d1z96a1

PDB Entry: 1z96 (more details), 1.8 Å

PDB Description: Crystal structure of the Mud1 UBA domain
PDB Compounds: (A:) UBA-domain protein mud1

SCOP Domain Sequences for d1z96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]}
glnskiaqlvsmgfdpleaaqaldaangdldvaasfll

SCOP Domain Coordinates for d1z96a1:

Click to download the PDB-style file with coordinates for d1z96a1.
(The format of our PDB-style files is described here.)

Timeline for d1z96a1:

763695
d1z96a1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1z96b1