![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
![]() | Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [141581] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141582] (4 PDB entries) Uniprot Q9M9P3 384-469 |
![]() | Domain d1z90a1: 1z90 A:384-469 [124732] Other proteins in same PDB: d1z90a2, d1z90b2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1z90 (more details), 1.86 Å
SCOPe Domain Sequences for d1z90a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z90a1 b.81.1.4 (A:384-469) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgssivlkgkvtva aksgvkleipdravvenkningpedl
Timeline for d1z90a1: