Lineage for d1z90a2 (1z90 A:6-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133197Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 protein domains)
  6. 2133223Protein UDP-glucose pyrophosphorylase 2 (UDPGP 2) [142686] (1 species)
  7. 2133224Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142687] (4 PDB entries)
    Uniprot Q9M9P3 6-383
  8. 2133231Domain d1z90a2: 1z90 A:6-383 [124733]
    Other proteins in same PDB: d1z90a1, d1z90b1

Details for d1z90a2

PDB Entry: 1z90 (more details), 1.86 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g03250, a putative udp-glucose pyrophosphorylase
PDB Compounds: (A:) AT3g03250 protein

SCOPe Domain Sequences for d1z90a2:

Sequence, based on SEQRES records: (download)

>d1z90a2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
enlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpyekmtp
vsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnky
gckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdke
gwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycm
evtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaik
klveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdl
llvqsdlytlvdgfvtrn

Sequence, based on observed residues (ATOM records): (download)

>d1z90a2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
enlpqlksavdgltemseseksgfislvsrylsgiewskiqtptdeivvpyekmtpvsqd
vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
ktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklve
adalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvq
sdlytlvdgfvtrn

SCOPe Domain Coordinates for d1z90a2:

Click to download the PDB-style file with coordinates for d1z90a2.
(The format of our PDB-style files is described here.)

Timeline for d1z90a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z90a1