Lineage for d1yu9a1 (1yu9 A:2-172)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846541Protein Rab4a [142247] (1 species)
  7. 1846542Species Human (Homo sapiens) [TaxId:9606] [142248] (3 PDB entries)
    Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184
  8. 1846544Domain d1yu9a1: 1yu9 A:2-172 [124045]
    complexed with gnp, mg, so4

Details for d1yu9a1

PDB Entry: 1yu9 (more details), 2.07 Å

PDB Description: GppNHp-Bound Rab4A
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1yu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu9a1 c.37.1.8 (A:2-172) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
kkdldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk

SCOPe Domain Coordinates for d1yu9a1:

Click to download the PDB-style file with coordinates for d1yu9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yu9a1: