Lineage for d1yr6a1 (1yr6 A:1-244)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologiesFamily c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
core: parallel beta-sheet of 7 strands; order 3241567
Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
PYRAB14380; belongs to Pfam PF03029Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
Uniprot Q9UYR9 30-273
Domain d1yr6a1: 1yr6 A:1-244 [123909]
Other proteins in same PDB: d1yr6a2
Details for d1yr6a1
PDB Entry: 1yr6 (more details), 2.15 Å
PDB Description: pab0955 crystal structure : a gtpase in apo form from pyrococcus abyssi
PDB Compounds: (A:) ATP(GTP)binding proteinSCOPe Domain Sequences for d1yr6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yr6a1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctc
SCOPe Domain Coordinates for d1yr6a1:
Click to download the PDB-style file with coordinates for d1yr6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yr6a1:
- d1yr6a1 first appeared in SCOP 1.73
- d1yr6a1 appears in SCOPe 2.06
- d1yr6a1 appears in the current release, SCOPe 2.08
View in 3D
