Lineage for d1yr6a1 (1yr6 A:1-244)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696642Protein ATP(GTP)-binding protein PAB0955 [142297] (1 species)
    PYRAB14380; belongs to Pfam PF03029
  7. 696643Species Pyrococcus abyssi [TaxId:29292] [142298] (7 PDB entries)
  8. 696649Domain d1yr6a1: 1yr6 A:1-244 [123909]

Details for d1yr6a1

PDB Entry: 1yr6 (more details), 2.15 Å

PDB Description: pab0955 crystal structure : a gtpase in apo form from pyrococcus abyssi
PDB Compounds: (A:) ATP(GTP)binding protein

SCOP Domain Sequences for d1yr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr6a1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}
mivvfvgtagsgkttltgefgrylednykvayvnldtgvkelpyepsidvrefvtveeim
regygpngaivesydrlmekfneylnkilrlekendyvlidtpgqmetflfhefgvrlme
nlpyplvvyisdpeilkkpndycfvrffallidlrlgattipalnkvdllseeekerhrk
yfedidyltarlkldpsmqglmaykmcsmmtevlppvrvlylsaktregfedletlayeh
yctc

SCOP Domain Coordinates for d1yr6a1:

Click to download the PDB-style file with coordinates for d1yr6a1.
(The format of our PDB-style files is described here.)

Timeline for d1yr6a1: