Lineage for d1yq3b2 (1yq3 B:115-247)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly opened
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) 
contains two Fe4-S4 clusters
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) Protein Succinate dehydogenase [81669] (3 species) Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries) 
Domain d1yq3b2: 1yq3 B:115-247 [230429]
Other proteins in same PDB: d1yq3b1, d1yq3c_, d1yq3d_
automated match to d2bs2b1
complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq
Details for d1yq3b2
PDB Entry: 1yq3 (more details), 2.2 Å
PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone
PDB Compounds: (B:) succinate dehydrogenase Ip subunitSCOPe Domain Sequences for d1yq3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq3b2 a.1.2.1 (B:115-247) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke
SCOPe Domain Coordinates for d1yq3b2:
Click to download the PDB-style file with coordinates for d1yq3b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yq3b2:
- d1yq3b2 first appeared in SCOPe 2.03
- d1yq3b2 appears in SCOPe 2.05
- d1yq3b2 appears in SCOPe 2.07
- d1yq3b2 appears in the current release, SCOPe 2.08
View in 3D
