| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
| Protein automated matches [230427] (2 species) not a true protein |
| Species Gallus gallus [TaxId:9031] [230428] (1 PDB entry) |
| Domain d1yq3b2: 1yq3 B:115-247 [230429] Other proteins in same PDB: d1yq3b1 automated match to d2bs2b1 complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq |
PDB Entry: 1yq3 (more details), 2.2 Å
SCOPe Domain Sequences for d1yq3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq3b2 a.1.2.0 (B:115-247) automated matches {Gallus gallus [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke
Timeline for d1yq3b2: