SCOPe 2.03: Domain d1yq3b2: 1yq3 B:115-247

Lineage for d1yq3b2 (1yq3 B:115-247)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (2 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [230428] (1 PDB entry)

8. Domain d1yq3b2: 1yq3 B:115-247 [230429]
   Other proteins in same PDB: d1yq3b1
   automated match to d2bs2b1
   complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq

Details for d1yq3b2

PDB Entry: 1yq3, 2.2 Å

PDB Description: avian respiratory complex ii with oxaloacetate and ubiquinone

PDB Compounds: (B:) succinate dehydrogenase Ip subunit

SCOPe Domain Sequences for d1yq3b2:

Sequence; same for both SEQRES and ATOM records:

>d1yq3b2 a.1.2.0 (B:115-247) automated matches {Gallus gallus [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke

Timeline for d1yq3b2:

• d1yq3b2 is new in SCOPe 2.03-stable
  
• d1yq3b2 appears in SCOPe 2.04
  
• d1yq3b2 appears in the current release, SCOPe 2.08