Lineage for d1yd8g1 (1yd8 G:208-299)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986092Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 1986093Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 1986103Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)
  7. 1986104Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
    Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300
  8. 1986109Domain d1yd8g1: 1yd8 G:208-299 [144631]
    Other proteins in same PDB: d1yd8g2, d1yd8h3, d1yd8u_, d1yd8v_

Details for d1yd8g1

PDB Entry: 1yd8 (more details), 2.8 Å

PDB Description: complex of human gga3 gat domain and ubiquitin
PDB Compounds: (G:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1yd8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yd8g1 a.7.8.1 (G:208-299) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
iqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklas
etedndnslgdilqasdnlsrvinsyktiieg

SCOPe Domain Coordinates for d1yd8g1:

Click to download the PDB-style file with coordinates for d1yd8g1.
(The format of our PDB-style files is described here.)

Timeline for d1yd8g1: