SCOPe 2.08: Domain d1yd8g1: 1yd8 G:208-299

Lineage for d1yd8g1 (1yd8 G:208-299)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.1: GAT domain [89010] (4 proteins)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga3 [158363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158364] (2 PDB entries)
   Uniprot Q9NZ52 208-299! Uniprot Q9NZ52 211-300

8. Domain d1yd8g1: 1yd8 G:208-299 [144631]
   Other proteins in same PDB: d1yd8g2, d1yd8h3, d1yd8u_, d1yd8v_

Details for d1yd8g1

PDB Entry: 1yd8, 2.8 Å

PDB Description: complex of human gga3 gat domain and ubiquitin

PDB Compounds: (G:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1yd8g1:

Sequence; same for both SEQRES and ATOM records:

>d1yd8g1 a.7.8.1 (G:208-299) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
iqkvtkrlhtleevnnnvrllsemllhysqedssdgdrelmkelfdqcenkrrtlfklas
etedndnslgdilqasdnlsrvinsyktiieg

Timeline for d1yd8g1:

• d1yd8g1 first appeared in SCOP 1.75
  
• d1yd8g1 appears in SCOPe 2.07