SCOPe 2.08: Domain d1y7pa2: 1y7p A:2-78

Lineage for d1y7pa2 (1y7p A:2-78)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (15 families)
regulatory domain linked to a wide range of metabolic enzymes
Family d.58.18.12: AF1403 N-terminal domain-like [143398] (1 protein)
dimerizes with the formation of a single intersubunit beta-sheet
automatically mapped to Pfam PF01842
Protein Hypothetical protein AF1403, N-terminal domain [143399] (1 species)
Species Archaeoglobus fulgidus [TaxId:2234] [143400] (1 PDB entry)
Uniprot O28869 2-78
Domain d1y7pa2: 1y7p A:2-78 [122709]
Other proteins in same PDB: d1y7pa1, d1y7pb1, d1y7pb3, d1y7pc1, d1y7pc3
complexed with rip, zn

Details for d1y7pa2

PDB Entry: 1y7p (more details), 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator

PDB Compounds: (A:) Hypothetical protein AF1403

SCOPe Domain Sequences for d1y7pa2:

Sequence, based on SEQRES records: (download)

>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
lrglriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfeki
lervktfdyiieieeee

Sequence, based on observed residues (ATOM records): (download)

>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
lrglriiaenkigvlrdlttiianitfaqtflikhgehegkaliyfeieggdfekilerv
ktfdyiieieeee

SCOPe Domain Coordinates for d1y7pa2:

Click to download the PDB-style file with coordinates for d1y7pa2.
(The format of our PDB-style files is described here.)

Timeline for d1y7pa2: