Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein) |
Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry) Uniprot O28869 79-217 |
Domain d1y7pc1: 1y7p C:79-219 [122712] Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pb3, d1y7pc2, d1y7pc3 automated match to d1y7pa1 complexed with rip, zn |
PDB Entry: 1y7p (more details), 1.9 Å
SCOPe Domain Sequences for d1y7pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7pc1 c.23.1.7 (C:79-219) Hypothetical protein AF1403, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl avmhisekakfdldrvkgrri
Timeline for d1y7pc1: