Lineage for d1y7pc2 (1y7p C:5-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954238Family d.58.18.12: AF1403 N-terminal domain-like [143398] (1 protein)
    dimerizes with the formation of a single intersubunit beta-sheet
    automatically mapped to Pfam PF01842
  6. 2954239Protein Hypothetical protein AF1403, N-terminal domain [143399] (1 species)
  7. 2954240Species Archaeoglobus fulgidus [TaxId:2234] [143400] (1 PDB entry)
    Uniprot O28869 2-78
  8. 2954243Domain d1y7pc2: 1y7p C:5-78 [122713]
    Other proteins in same PDB: d1y7pa1, d1y7pb1, d1y7pb3, d1y7pc1, d1y7pc3
    automated match to d1y7pa2
    complexed with rip, zn

Details for d1y7pc2

PDB Entry: 1y7p (more details), 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
PDB Compounds: (C:) Hypothetical protein AF1403

SCOPe Domain Sequences for d1y7pc2:

Sequence, based on SEQRES records: (download)

>d1y7pc2 d.58.18.12 (C:5-78) Hypothetical protein AF1403, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
lriiaenkigvlrdlttiiaeeggnitfaqtflikhgehegkaliyfeieggdfekiler
vktfdyiieieeee

Sequence, based on observed residues (ATOM records): (download)

>d1y7pc2 d.58.18.12 (C:5-78) Hypothetical protein AF1403, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
lriiaenkigvlrdlttiiaeeitfaqtflikhgehegkaliyfeilervktfdyiieie
eee

SCOPe Domain Coordinates for d1y7pc2:

Click to download the PDB-style file with coordinates for d1y7pc2.
(The format of our PDB-style files is described here.)

Timeline for d1y7pc2: