Lineage for d1y5ea1 (1y5e A:12-166)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142860Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2142861Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2142862Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2142870Protein MoaB [89722] (2 species)
  7. 2142871Species Bacillus cereus [TaxId:1396] [142542] (1 PDB entry)
    Uniprot Q816R0 12-166
  8. 2142872Domain d1y5ea1: 1y5e A:12-166 [122632]
    complexed with imd, mpd

Details for d1y5ea1

PDB Entry: 1y5e (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein B
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d1y5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]}
kevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyhke
dvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggt
igrkvvfsmpgssgavrlamnklilpelghitfel

SCOPe Domain Coordinates for d1y5ea1:

Click to download the PDB-style file with coordinates for d1y5ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y5ea1: