Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.1: MogA-like [53219] (6 proteins) |
Protein MoaB [89722] (2 species) |
Species Bacillus cereus [TaxId:1396] [142542] (1 PDB entry) Uniprot Q816R0 12-166 |
Domain d1y5ea1: 1y5e A:12-166 [122632] complexed with imd, mpd |
PDB Entry: 1y5e (more details), 1.9 Å
SCOPe Domain Sequences for d1y5ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]} kevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyhke dvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggt igrkvvfsmpgssgavrlamnklilpelghitfel
Timeline for d1y5ea1: