Lineage for d1y5ea1 (1y5e A:12-166)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703405Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 703406Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 703407Family c.57.1.1: MogA-like [53219] (5 proteins)
  6. 703415Protein MoaB [89722] (2 species)
  7. 703416Species Bacillus cereus [TaxId:1396] [142542] (1 PDB entry)
  8. 703417Domain d1y5ea1: 1y5e A:12-166 [122632]
    complexed with imd, mpd

Details for d1y5ea1

PDB Entry: 1y5e (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein B
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein B

SCOP Domain Sequences for d1y5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]}
kevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyhke
dvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggt
igrkvvfsmpgssgavrlamnklilpelghitfel

SCOP Domain Coordinates for d1y5ea1:

Click to download the PDB-style file with coordinates for d1y5ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y5ea1: