![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (5 proteins) |
![]() | Protein MoaB [89722] (2 species) |
![]() | Species Bacillus cereus [TaxId:1396] [142542] (1 PDB entry) |
![]() | Domain d1y5ea1: 1y5e A:12-166 [122632] complexed with imd, mpd |
PDB Entry: 1y5e (more details), 1.9 Å
SCOP Domain Sequences for d1y5ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]} kevrckivtisdtrteetdksgqllhellkeaghkvtsyeivkddkesiqqavlagyhke dvdvvltnggtgitkrdvtieavsalldkeivgfgelfrmisyledigssamlsraiggt igrkvvfsmpgssgavrlamnklilpelghitfel
Timeline for d1y5ea1: