Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein Hit [117789] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117790] (1 PDB entry) Uniprot O07513 |
Domain d1y23b_: 1y23 B: [116395] Structural genomics target complexed with mg, zn |
PDB Entry: 1y23 (more details), 2.3 Å
SCOPe Domain Sequences for d1y23b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y23b_ d.13.1.1 (B:) Hit {Bacillus subtilis [TaxId: 1423]} encifckiiagdipsakvyedehvlafldisqvtkghtlvipkthienvyeftdelakqy fhavpkiarairdefepiglntlnnngekagqsvfhyhmhiiprygkgdgfgavwkthad dykpedlqnisssiakrlass
Timeline for d1y23b_:
View in 3D Domains from other chains: (mouse over for more information) d1y23a_, d1y23c_, d1y23d_, d1y23e_ |