Lineage for d1xw5a1 (1xw5 A:85-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713057Protein Class mu GST [81348] (3 species)
  7. 2713065Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
    Uniprot P09488 P28161
  8. 2713069Domain d1xw5a1: 1xw5 A:85-217 [116099]
    Other proteins in same PDB: d1xw5a2, d1xw5b2
    complexed with gsh

Details for d1xw5a1

PDB Entry: 1xw5 (more details), 1.8 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form
PDB Compounds: (A:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d1xw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xw5a1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

SCOPe Domain Coordinates for d1xw5a1:

Click to download the PDB-style file with coordinates for d1xw5a1.
(The format of our PDB-style files is described here.)

Timeline for d1xw5a1:

2713069
d1xw5a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1xw5a2