Lineage for d1xv1a_ (1xv1 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
Pfam PF00685
similar to the nucleotide/nucleoside kinases but transfer sulphate group
Protein Thyroid hormone sulfotransferase Sult1b1 [117530] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117531] (2 PDB entries)
Uniprot O43704
Domain d1xv1a_: 1xv1 A: [303373]
automated match to d3cklb_
complexed with a3p
Details for d1xv1a_
PDB Entry: 1xv1 (more details), 2.1 Å
PDB Description: Human sulfotransferase SULT1B1 in complex with PAP
PDB Compounds: (A:) sulfotransferaseSCOPe Domain Sequences for d1xv1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xv1a_ c.37.1.5 (A:) Thyroid hormone sulfotransferase Sult1b1 {Human (Homo sapiens) [TaxId: 9606]}
pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkk
keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
SCOPe Domain Coordinates for d1xv1a_:
Click to download the PDB-style file with coordinates for d1xv1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xv1a_:
- d1xv1a_ first appeared in SCOPe 2.06
- d1xv1a_ appears in SCOPe 2.07
View in 3D
