![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins) Pfam PF00685 similar to the nucleotide/nucleoside kinases but transfer sulphate group |
![]() | Protein automated matches [190189] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries) |
![]() | Domain d3cklb_: 3ckl B: [173290] automated match to d1xv1a_ complexed with a3p, stl |
PDB Entry: 3ckl (more details), 2 Å
SCOPe Domain Sequences for d3cklb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cklb_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidm ilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfw ennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknw wkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvn ythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei
Timeline for d3cklb_: