Lineage for d3cklb_ (3ckl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866454Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2866543Protein automated matches [190189] (4 species)
    not a true protein
  7. 2866551Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)
  8. 2866553Domain d3cklb_: 3ckl B: [173290]
    automated match to d1xv1a_
    complexed with a3p, stl

Details for d3cklb_

PDB Entry: 3ckl (more details), 2 Å

PDB Description: Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol
PDB Compounds: (B:) Sulfotransferase family cytosolic 1B member 1

SCOPe Domain Sequences for d3cklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cklb_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlspkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidm
ilndgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfw
ennckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknw
wkkkeehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvn
ythlpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei

SCOPe Domain Coordinates for d3cklb_:

Click to download the PDB-style file with coordinates for d3cklb_.
(The format of our PDB-style files is described here.)

Timeline for d3cklb_: