Lineage for d1xuua2 (1xuu A:2-281)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structure
Family c.1.10.6: NeuB-like [110368] (3 proteins)
Pfam PF03102
Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species) - Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries)
Uniprot Q57265 
Domain d1xuua2: 1xuu A:2-281 [116068]
Other proteins in same PDB: d1xuua1
complexed with mlt, mn
Details for d1xuua2
PDB Entry: 1xuu (more details), 1.9 Å
PDB Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaCSCOPe Domain Sequences for d1xuua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuua2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
SCOPe Domain Coordinates for d1xuua2:
Click to download the PDB-style file with coordinates for d1xuua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xuua2:
- d1xuua2 first appeared in SCOP 1.71
- d1xuua2 appears in SCOPe 2.07
View in 3D
