PDB entry 1xuu

View 1xuu on RCSB PDB site
Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis
Class: biosynthetic protein
Keywords: TIM barrel, Antifreeze-like domain, Domain-swapped dimer, BIOSYNTHETIC PROTEIN
Deposited on 2004-10-26, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polysialic acid capsule biosynthesis protein SiaC
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xuua1, d1xuua2
  • Heterogens: MN, MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xuuA (A:)
    mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
    demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
    qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
    hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
    mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdik
    kgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuuA (A:)
    qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
    emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
    rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
    ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
    drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdikk
    gellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie