Lineage for d1xuua2 (1xuu A:2-281)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572959Family c.1.10.6: NeuB-like [110368] (2 proteins)
    Pfam 03102
  6. 572960Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (1 species)
  7. 572961Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries)
  8. 572962Domain d1xuua2: 1xuu A:2-281 [116068]
    Other proteins in same PDB: d1xuua1
    complexed with mlt, mn

Details for d1xuua2

PDB Entry: 1xuu (more details), 1.9 Å

PDB Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis

SCOP Domain Sequences for d1xuua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuua2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOP Domain Coordinates for d1xuua2:

Click to download the PDB-style file with coordinates for d1xuua2.
(The format of our PDB-style files is described here.)

Timeline for d1xuua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuua1