Lineage for d1xsna2 (1xsn A:329-385)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738432Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1738609Protein DNA polymerase lambda [101253] (1 species)
  7. 1738610Species Human (Homo sapiens) [TaxId:9606] [101254] (26 PDB entries)
  8. 1738616Domain d1xsna2: 1xsn A:329-385 [122283]
    Other proteins in same PDB: d1xsna1, d1xsna3
    automatically matched to d1rzta2
    protein/DNA complex; complexed with d3t, edo, mg, na

Details for d1xsna2

PDB Entry: 1xsn (more details), 1.95 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap and ddttp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d1xsna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsna2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d1xsna2:

Click to download the PDB-style file with coordinates for d1xsna2.
(The format of our PDB-style files is described here.)

Timeline for d1xsna2: