Lineage for d1xsna2 (1xsn A:329-385)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643336Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643337Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 643464Protein DNA polymerase lambda [101253] (1 species)
  7. 643465Species Human (Homo sapiens) [TaxId:9606] [101254] (14 PDB entries)
  8. 643469Domain d1xsna2: 1xsn A:329-385 [122283]
    Other proteins in same PDB: d1xsna1, d1xsna3
    automatically matched to d1rzta2
    complexed with 2dt, d3t, edo, mg, na; mutant

Details for d1xsna2

PDB Entry: 1xsn (more details), 1.95 Å

PDB Description: crystal structure of human dna polymerase lambda in complex with a one nucleotide dna gap and ddttp
PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d1xsna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsna2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOP Domain Coordinates for d1xsna2:

Click to download the PDB-style file with coordinates for d1xsna2.
(The format of our PDB-style files is described here.)

Timeline for d1xsna2: